PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000909.1.g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family EIL
Protein Properties Length: 602aa    MW: 67768.4 Da    PI: 4.9562
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000909.1.g00007.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3499.41.9e-152454161354
                                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipe 79 
                                     +el++rmw+d++llkrl+e+++     kea ++++++++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipe
  FANhyb_rscf00000909.1.g00007.1  45 DELERRMWRDRILLKRLREQTRG----KEA-ADNARQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPE 118
                                     79******************998....666.788899****************************************** PP

                                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS- CS
                            EIN3  80 kgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdpp 158
                                     kgkpv+gasd+Lr+WWkekv+fdrngpaaiskyqa+n+i++  +++ ++  s++h+l+elqDTtlgSLLsalmqhcdpp
  FANhyb_rscf00000909.1.g00007.1 119 KGKPVSGASDNLREWWKEKVRFDRNGPAAISKYQAENAIPGMMEDC-ISVASTPHTLQELQDTTLGSLLSALMQHCDPP 196
                                     *******************************************999.669***************************** PP

                                     TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT CS
                            EIN3 159 qrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdk 237
                                     qrrfplekgv+pPWWPtG+e+ww++l l+kdqg+ppykkphdlkkawkvsvLtavikhmsp+i++ir+l+rqsk+lqdk
  FANhyb_rscf00000909.1.g00007.1 197 QRRFPLEKGVSPPWWPTGNEEWWPQLNLAKDQGPPPYKKPHDLKKAWKVSVLTAVIKHMSPDINKIRKLVRQSKCLQDK 275
                                     ******************************************************************************* PP

                                     --SHHHHHHHHHHTTTTT-S--XXXX..XXXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX............ CS
                            EIN3 238 msakesfallsvlnqeekecatvsah..ssslrkqspkvtlsceqkedvegkkeskikhvqavktta............ 302
                                     m+akes+++l+++nqee +++++ ++  ++ +  +s ++++s+ +++dveg ++ +  +v+ +k               
  FANhyb_rscf00000909.1.g00007.1 276 MTAKESATWLAIINQEEVLARRMFPDicPPLSAGGSGSFVISDTSDYDVEGVDDDQDVEVEDCKPLLdhfnmgtigqrp 354
                                     **************************96556667****************77777656677776655899********* PP

                                     .........XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXX.XXXXXXXXXXXXX CS
                            EIN3 303 .........gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetel.ifadknsisqney 354
                                              + ++ +krk++++e+ +++ ++ ++tc+  q+++s++++ +f+d ++++++++
  FANhyb_rscf00000909.1.g00007.1 355 qfkgelietNSDFGKKRKQQQAEEPQMMLNQKVYTCEFLQCPHSDSRFgGFSDITARNNHQM 416
                                     *********99******9999888888878788**************9459********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.3E-12945292No hitNo description
Gene3DG3DSA:1.10.3180.107.1E-75166302IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.31E-61171295IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MGIFEDMGFC GNLDFFSAPA GEGEVVPEPE ATVEEDYSDE ELDVDELERR MWRDRILLKR  60
LREQTRGKEA ADNARQRQSQ EQARRKKMSR AQDGILKYML KMMEVCKAQG FVYGIIPEKG  120
KPVSGASDNL REWWKEKVRF DRNGPAAISK YQAENAIPGM MEDCISVAST PHTLQELQDT  180
TLGSLLSALM QHCDPPQRRF PLEKGVSPPW WPTGNEEWWP QLNLAKDQGP PPYKKPHDLK  240
KAWKVSVLTA VIKHMSPDIN KIRKLVRQSK CLQDKMTAKE SATWLAIINQ EEVLARRMFP  300
DICPPLSAGG SGSFVISDTS DYDVEGVDDD QDVEVEDCKP LLDHFNMGTI GQRPQFKGEL  360
IETNSDFGKK RKQQQAEEPQ MMLNQKVYTC EFLQCPHSDS RFGGFSDITA RNNHQMSCPY  420
RNNCSPVFGM PNLLNNDKPV GFPLPVAQAK PAIIQQVNPT SPFNVSGLGL ADDGQKMISE  480
LMSSYDGNTQ QTSNPGNFSA VQDPNHQQVN YQFEVGDHFY SQGMVMDRSN VPEPTPMPMH  540
QQVLPSPEVQ FDQCKVFDSS FGNNSNDAIA DLRFGTQFSL AQLGYTAGNS LLKQDASSIW  600
YI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_B6e-801693011133Protein ETHYLENE INSENSITIVE 3
4zds_A6e-801693011133Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004306440.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0MQ940.0A0MQ94_PRUPE; EIL2
STRINGVIT_13s0047g00250.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein